PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g54640.1.p
Common NameBRADI_2g54640, LOC100843336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 571aa    MW: 62477.1 Da    PI: 7.7932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g54640.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.6e-1764110148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT++Ede l +av+ + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Bradi2g54640.1.p  64 KGGWTPQEDETLRKAVQAFKGRSWKKIAEFFP-DRTEVQCLHRWQKVL 110
                       688*****************************.************986 PP

2Myb_DNA-binding61.32.1e-19116162148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd++++ +vk++G+  W+ Iar ++ gR +kqc++rw+++l
  Bradi2g54640.1.p 116 KGPWTQEEDDKIIALVKEYGPTKWSVIARSLP-GRIGKQCRERWHNHL 162
                       79******************************.*************97 PP

3Myb_DNA-binding57.53.1e-18168210145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +++WT+eE+  l++a++ +G++ W+ Ia+ ++ gRt++++k++w+
  Bradi2g54640.1.p 168 KDAWTAEEERALINAHQTYGNK-WAEIAKVLP-GRTDNSIKNHWN 210
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.65159110IPR017930Myb domain
SMARTSM007171.9E-1463112IPR001005SANT/Myb domain
PfamPF002491.6E-1564110IPR001005SANT/Myb domain
SuperFamilySSF466894.16E-1565120IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-2366126IPR009057Homeodomain-like
CDDcd001679.09E-1367110No hitNo description
PROSITE profilePS5129431.526111166IPR017930Myb domain
SuperFamilySSF466893.29E-32113209IPR009057Homeodomain-like
SMARTSM007171.6E-18115164IPR001005SANT/Myb domain
PfamPF002496.8E-18116162IPR001005SANT/Myb domain
CDDcd001671.85E-16118162No hitNo description
Gene3DG3DSA:1.10.10.601.0E-27127170IPR009057Homeodomain-like
SMARTSM007173.7E-18167215IPR001005SANT/Myb domain
PROSITE profilePS5129422.611167217IPR017930Myb domain
PfamPF002491.5E-16168211IPR001005SANT/Myb domain
CDDcd001671.38E-14170210No hitNo description
Gene3DG3DSA:1.10.10.602.9E-24171217IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MRAMAEVEHE GCVENRQPLA ASSSSVSDGS SYGVGLARMS PPVSSSVNSI SGLRRTSGPI  60
RRAKGGWTPQ EDETLRKAVQ AFKGRSWKKI AEFFPDRTEV QCLHRWQKVL NPELIKGPWT  120
QEEDDKIIAL VKEYGPTKWS VIARSLPGRI GKQCRERWHN HLNPDIKKDA WTAEEERALI  180
NAHQTYGNKW AEIAKVLPGR TDNSIKNHWN SSVRKKLDVY STSKILAVPR LVGHNDFKDK  240
PKPVANEGHL DLNKVAIVSS KDIPETAQRS NLNHVNDCSG FLSLSILPTD QPLTSYEVSS  300
VVDGSAVTLA VQGLESDSVR EKGLEILSVH EKGLEADSTL DTLAESGTTQ LESVPAKGEE  360
PSLKNEAQSS LGPLCYQIPN MEDVAPVTSP LFSEHHTMHQ TSEHCRDVVL SPNGCTTPAK  420
GTISSQLSVD SILKSAADSF PSTPSILRRR KRDKSTPASD LRFGGLNTDS FYTPAGKRPT  480
TDTPESFKTA SFLSLGSLDQ LSASVRSFDV SPPYRIRSKR TAVTRTVEKQ LDFSADELGT  540
CGSKILDSPC QNSLNTNSFT DAPMMEGNKT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-73632175159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-73632175159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448453RRKRDK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2364940.0HQ236494.1 Triticum aestivum MYB3R transcription factor (MYB3R1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232544.20.0PREDICTED: myb-related protein A-like
TrEMBLI1HT970.0I1HT97_BRADI; Uncharacterized protein
STRINGBRADI2G54640.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-106myb domain protein 3r-5